MTHFD2L antibody

Catalog No. ABIN631982

Product Details anti-MTHFD2L Antibody

Target: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTHFD2L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MTHFD2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTHFD2L Blocking Peptide, catalog no. 33R-9087, is also available for use as a blocking control in assays to test for specificity of this MTHFD2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTHFD2L

Target: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Alternative Name: MTHFD2L (MTHFD2L Products)

Synonyms: wu:fi14c12 antibody, zgc:63479 antibody, 1110019K23Rik antibody, C630010D07Rik antibody, RGD1310879 antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like antibody, MTHFD2L antibody, mthfd2l antibody, Mthfd2l antibody

Background: The function of MTHFD2L protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)