RSPH10B antibody
-
- Target See all RSPH10B products
- RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RSPH10B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPH10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))
- Alternative Name
- RSPH10B (RSPH10B Products)
- Background
- The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 96 kDa (MW of target protein)
-