NHLRC2 antibody (N-Term)

Catalog No. ABIN631979

Product Details anti-NHLRC2 Antibody

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHLRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NHLRC2 antibody was raised against the N terminal of NHLRC2

Purification: Affinity purified

Immunogen: NHLRC2 antibody was raised using the N terminal of NHLRC2 corresponding to a region with amino acids YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NHLRC2 Blocking Peptide, catalog no. 33R-10237, is also available for use as a blocking control in assays to test for specificity of this NHLRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHLRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHLRC2

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Alternative Name: NHLRC2 (NHLRC2 Products)

Synonyms: 1200003G01Rik antibody, AI835049 antibody, AV002846 antibody, AW496455 antibody, NHL repeat containing 2 antibody, NHLRC2 antibody, Nhlrc2 antibody

Background: The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 79 kDa (MW of target protein)