RWDD4A antibody (Middle Region)

Catalog No. ABIN631971

Product Details anti-RWDD4A Antibody

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RWDD4A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RWDD4 A antibody was raised against the middle region of RWDD4

Purification: Affinity purified

Immunogen: RWDD4 A antibody was raised using the middle region of RWDD4 corresponding to a region with amino acids SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RWDD4A Blocking Peptide, catalog no. 33R-8816, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RWDD4A

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Alternative Name: RWDD4A (RWDD4 Products)

Synonyms: BC016198 antibody, Gm1942 antibody, Rwdd4 antibody, FAM28A antibody, RWDD4A antibody, fam28a antibody, rwdd4a antibody, Rwdd4a antibody, si:ch211-192e21.1 antibody, zgc:103545 antibody, RWD domain containing 4A antibody, RWD domain containing 4 antibody, RWD domain containing 4 L homeolog antibody, Rwdd4a antibody, RWDD4 antibody, rwdd4.L antibody, Rwdd4 antibody, rwdd antibody

Background: The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 21 kDa (MW of target protein)