FSIP1 antibody (Middle Region)

Catalog No. ABIN631970

Product Details anti-FSIP1 Antibody

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FSIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FSIP1 antibody was raised against the middle region of FSIP1

Purification: Affinity purified

Immunogen: FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FSIP1 Blocking Peptide, catalog no. 33R-1906, is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FSIP1

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Alternative Name: FSIP1 (FSIP1 Products)

Synonyms: zgc:113106 antibody, 1700012M13Rik antibody, 4933432K11Rik antibody, fibrous sheath interacting protein 1 antibody, fibrous sheath-interacting protein 1 antibody, FSIP1 antibody, Fsip1 antibody, fsip1 antibody

Background: The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 66 kDa (MW of target protein)