SPICE1 antibody (N-Term)
-
- Target See all SPICE1 Antibodies
- SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPICE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC52 antibody was raised against the N terminal of CCDC52
- Purification
- Affinity purified
- Immunogen
- CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET
- Top Product
- Discover our top product SPICE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC52 Blocking Peptide, catalog no. 33R-9371, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC52 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))
- Alternative Name
- CCDC52 (SPICE1 Products)
- Synonyms
- CCDC52 antibody, ccdc52 antibody, zgc:101558 antibody, SPICE antibody, Ccdc52 antibody, D16Ertd480e antibody, RGD1310729 antibody, spindle and centriole associated protein 1 antibody, spindle and centriole associated protein 1 L homeolog antibody, SPICE1 antibody, spice1 antibody, Spice1 antibody, spice1.L antibody
- Background
- The specific function of CCDC52 is not yet known.
- Molecular Weight
- 96 kDa (MW of target protein)
-