SPICE1 antibody (N-Term)

Catalog No. ABIN631969

Product Details anti-SPICE1 Antibody

Target: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPICE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC52 antibody was raised against the N terminal of CCDC52

Purification: Affinity purified

Immunogen: CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC52 Blocking Peptide, catalog no. 33R-9371, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPICE1

Target: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Alternative Name: CCDC52 (SPICE1 Products)

Synonyms: CCDC52 antibody, ccdc52 antibody, zgc:101558 antibody, SPICE antibody, Ccdc52 antibody, D16Ertd480e antibody, RGD1310729 antibody, spindle and centriole associated protein 1 antibody, spindle and centriole associated protein 1 L homeolog antibody, SPICE1 antibody, spice1 antibody, Spice1 antibody, spice1.L antibody

Background: The specific function of CCDC52 is not yet known.

Molecular Weight: 96 kDa (MW of target protein)