FBP2 antibody (Middle Region)
-
- Target See all FBP2 Antibodies
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBP2 antibody was raised against the middle region of FBP2
- Purification
- Affinity purified
- Immunogen
- FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY
- Top Product
- Discover our top product FBP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBP2 Blocking Peptide, catalog no. 33R-10051, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
- Alternative Name
- FBP2 (FBP2 Products)
- Synonyms
- 6330409F21Rik antibody, Fbp2 antibody, Fubp2 antibody, Ksrp antibody, Fbp-1 antibody, Fbp1 antibody, Rae-30 antibody, FBPase antibody, zgc:101083 antibody, FBP2 antibody, MGC108013 antibody, FBP antibody, fructose-bisphosphatase 2 antibody, KH-type splicing regulatory protein antibody, fructose bisphosphatase 2 antibody, fructose-1,6-bisphosphatase 2 antibody, fructose-bisphosphatase 2 L homeolog antibody, FBP2 antibody, Khsrp antibody, Fbp2 antibody, fbp2 antibody, fbp2.L antibody
- Background
- FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.
- Molecular Weight
- 37 kDa (MW of target protein)
-