WDR1 antibody (N-Term)

Catalog No. ABIN631958

Product Details anti-WDR1 Antibody

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR1 antibody was raised against the N terminal of WDR1

Purification: Affinity purified

Immunogen: WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR1 Blocking Peptide, catalog no. 33R-1988, is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR1

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Alternative Name: WDR1 (WDR1 Products)

Synonyms: AIP1 antibody, NORI-1 antibody, Aip1 antibody, D5Wsu185e antibody, rede antibody, aip1 antibody, wdr1b antibody, wu:fa66e09 antibody, zgc:55793 antibody, zgc:77547 antibody, wdr1 antibody, wdr1-a antibody, wdr1-b antibody, wdr1a antibody, xAIP1-B antibody, WD repeat domain 1 antibody, WD repeat domain 1 L homeolog antibody, WD repeat domain 1 S homeolog antibody, WDR1 antibody, Wdr1 antibody, wdr1.L antibody, wdr1 antibody, wdr1.S antibody

Background: WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Sensory Perception of Sound