WDR1 antibody (N-Term)
-
- Target See all WDR1 Antibodies
- WDR1 (WD Repeat Domain 1 (WDR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WDR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WDR1 antibody was raised against the N terminal of WDR1
- Purification
- Affinity purified
- Immunogen
- WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ
- Top Product
- Discover our top product WDR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDR1 Blocking Peptide, catalog no. 33R-1988, is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR1 (WD Repeat Domain 1 (WDR1))
- Alternative Name
- WDR1 (WDR1 Products)
- Background
- WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.
- Molecular Weight
- 66 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-