ADH5 antibody
-
- Target See all ADH5 Antibodies
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADH5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV
- Top Product
- Discover our top product ADH5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
- Alternative Name
- ADH5 (ADH5 Products)
- Synonyms
- ADH2 antibody, ADH-3 antibody, ADHX antibody, FALDH antibody, FDH antibody, GSH-FDH antibody, GSNOR antibody, ADH1C antibody, ADH3 antibody, wu:fb60b11 antibody, Adh-5 antibody, Adh3 antibody, adh-3 antibody, adh3 antibody, adh5 antibody, adhx antibody, fdh antibody, gsnor antibody, ADH4 antibody, ADH5 antibody, alcohol dehydrogenase 1B (class I), beta polypeptide antibody, alcohol dehydrogenase 5 (class III), chi polypeptide antibody, alcohol dehydrogenase 5 antibody, alcohol dehydrogenase 5 (class III), chi polypeptide L homeolog antibody, alcohol dehydrogenase class-3 antibody, ADH1B antibody, ADH5 antibody, adh5 antibody, Adh5 antibody, adh5.L antibody, LOC101112223 antibody
- Background
- This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
- Molecular Weight
- 40 kDa (MW of target protein)
-