GSG1 antibody (N-Term)

Catalog No. ABIN631943

Product Details anti-GSG1 Antibody

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSG1 antibody was raised against the N terminal of GSG1

Purification: Affinity purified

Immunogen: GSG1 antibody was raised using the N terminal of GSG1 corresponding to a region with amino acids NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSG1 Blocking Peptide, catalog no. 33R-6947, is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSG1

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Alternative Name: GSG1 (GSG1 Products)

Synonyms: germ cell associated 1 antibody, GSG1 antibody, Gsg1 antibody

Background: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Molecular Weight: 41 kDa (MW of target protein)