FKBPL antibody (N-Term)

Catalog No. ABIN631941

Product Details anti-FKBPL Antibody

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBPL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FKBPL antibody was raised against the N terminal of FKBPL

Purification: Affinity purified

Immunogen: FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBPL Blocking Peptide, catalog no. 33R-5971, is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBPL

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Alternative Name: FKBPL (FKBPL Products)

Synonyms: FKBPL antibody, ng7 antibody, dir1 antibody, wisp39 antibody, DIR1 antibody, NG7 antibody, WISP39 antibody, Ppiase-X antibody, Wisp39 antibody, FK506 binding protein like antibody, FK506 binding protein-like antibody, FKBPL antibody, fkbpl antibody, Fkbpl antibody

Background: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking.

Molecular Weight: 38 kDa (MW of target protein)