PRAMEF10 antibody (Middle Region)
-
- Target See all PRAMEF10 products
- PRAMEF10 (PRAME Family Member 10 (PRAMEF10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRAMEF10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRAMEF10 antibody was raised against the middle region of PRAMEF10
- Purification
- Affinity purified
- Immunogen
- PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRAMEF10 Blocking Peptide, catalog no. 33R-2057, is also available for use as a blocking control in assays to test for specificity of this PRAMEF10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAMEF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAMEF10 (PRAME Family Member 10 (PRAMEF10))
- Alternative Name
- PRAMEF10 (PRAMEF10 Products)
- Synonyms
- RP5-845O24.7 antibody, PRAME family member 10 antibody, PRAMEF10 antibody
- Background
- PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.
- Molecular Weight
- 55 kDa (MW of target protein)
-