FAM92B antibody (N-Term)

Catalog No. ABIN631935

Product Details anti-FAM92B Antibody

Target: FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM92B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM92 B antibody was raised against the N terminal of FAM92

Purification: Affinity purified

Immunogen: FAM92 B antibody was raised using the N terminal of FAM92 corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM92B Blocking Peptide, catalog no. 33R-2839, is also available for use as a blocking control in assays to test for specificity of this FAM92B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM92B

Target: FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))

Alternative Name: FAM92B (FAM92B Products)

Synonyms: 1700120B06Rik antibody, RGD1560673 antibody, family with sequence similarity 92 member B antibody, family with sequence similarity 92, member B antibody, FAM92B antibody, Fam92b antibody

Background: The function of FAM92 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)