LRRC50 antibody (N-Term)

Catalog No. ABIN631930

Product Details anti-LRRC50 Antibody

Target: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC50 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC50 antibody was raised against the N terminal of LRRC50

Purification: Affinity purified

Immunogen: LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC50 Blocking Peptide, catalog no. 33R-5219, is also available for use as a blocking control in assays to test for specificity of this LRRC50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC50

Target: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Alternative Name: LRRC50 (LRRC50 Products)

Synonyms: 4930457P18Rik antibody, Lrrc50 antibody, LRRC50 antibody, CILD13 antibody, ODA7 antibody, LLRC50 antibody, RGD1310542 antibody, lrrc50 antibody, zgc:56169 antibody, dynein, axonemal assembly factor 1 antibody, dynein axonemal assembly factor 1 antibody, dynein, axonemal, assembly factor 1 antibody, Dnaaf1 antibody, DNAAF1 antibody, dnaaf1 antibody

Background: LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.

Molecular Weight: 80 kDa (MW of target protein)