TTC12 antibody (C-Term)
-
- Target See all TTC12 products
- TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTC12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TTC12 antibody was raised against the C terminal of TTC12
- Purification
- Affinity purified
- Immunogen
- TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTC12 Blocking Peptide, catalog no. 33R-6251, is also available for use as a blocking control in assays to test for specificity of this TTC12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))
- Alternative Name
- TTC12 (TTC12 Products)
- Synonyms
- TPARM antibody, E330017O07Rik antibody, tetratricopeptide repeat domain 12 antibody, TTC12 antibody, Ttc12 antibody
- Background
- TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
- Molecular Weight
- 81 kDa (MW of target protein)
-