C16orf78 antibody (Middle Region)

Catalog No. ABIN631923

Product Details anti-C16orf78 Antibody

Target: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C16orf78 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 ORF78 antibody was raised against the middle region of C16 rf78

Purification: Affinity purified

Immunogen: C16 ORF78 antibody was raised using the middle region of C16 rf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16ORF78 Blocking Peptide, catalog no. 33R-3634, is also available for use as a blocking control in assays to test for specificity of this C16ORF78 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C16orf78

Target: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Alternative Name: C16ORF78 (C16orf78 Products)

Synonyms: chromosome 16 open reading frame 78 antibody, C16orf78 antibody

Background: The function of C16orf78 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)