C16orf78 antibody (Middle Region)
-
- Target See all C16orf78 products
- C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C16orf78 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C16 ORF78 antibody was raised against the middle region of C16 rf78
- Purification
- Affinity purified
- Immunogen
- C16 ORF78 antibody was raised using the middle region of C16 rf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C16ORF78 Blocking Peptide, catalog no. 33R-3634, is also available for use as a blocking control in assays to test for specificity of this C16ORF78 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))
- Alternative Name
- C16ORF78 (C16orf78 Products)
- Synonyms
- chromosome 16 open reading frame 78 antibody, C16orf78 antibody
- Background
- The function of C16orf78 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 34 kDa (MW of target protein)
-