CAPZA3 antibody
-
- Target See all CAPZA3 Antibodies
- CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAPZA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC
- Top Product
- Discover our top product CAPZA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAPZA3 Blocking Peptide, catalog no. 33R-6555, is also available for use as a blocking control in assays to test for specificity of this CAPZA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPZA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))
- Alternative Name
- CAPZA3 (CAPZA3 Products)
- Background
- F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-