MVK antibody (N-Term)

Catalog No. ABIN631917

Product Details anti-MVK Antibody

Target: MVK (Mevalonate Kinase (MVK))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MVK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MVK antibody was raised against the N terminal of MVK

Purification: Affinity purified

Immunogen: MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MVK Blocking Peptide, catalog no. 33R-4807, is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MVK

Target: MVK (Mevalonate Kinase (MVK))

Alternative Name: MVK (MVK Products)

Synonyms: F21A20.160 antibody, F21A20_160 antibody, MEVALONATE KINASE antibody, MVK antibody, mevalonate kinase antibody, DDBDRAFT_0168621 antibody, DDBDRAFT_0302479 antibody, DDB_0168621 antibody, DDB_0302479 antibody, LRBP antibody, MK antibody, MVLK antibody, POROK3 antibody, 2310010A05Rik antibody, AI256848 antibody, AI414037 antibody, zgc:103473 antibody, mevalonate kinase antibody, mvk antibody, hypothetical protein antibody, MVK antibody, MK antibody, MA_RS03165 antibody, PAB_RS02890 antibody, LMOf2365_0011 antibody, mvk antibody, RCI_RS14145 antibody, TGAM_RS08735 antibody, MMAH_RS07705 antibody, TAGG_RS01605 antibody, SHELL_RS02965 antibody, MVOL_RS03085 antibody, Igag_1464 antibody, VDIS_RS11260 antibody, MFER_RS04560 antibody, DESMU_RS01555 antibody, ARCVE_RS02955 antibody, MZHIL_RS05110 antibody, Mvk antibody

Background: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Molecular Weight: 42 kDa (MW of target protein)