DOK5 antibody (N-Term)
-
- Target See all DOK5 Antibodies
- DOK5 (Docking Protein 5 (DOK5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DOK5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DOK5 antibody was raised against the N terminal of DOK5
- Purification
- Affinity purified
- Immunogen
- DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD
- Top Product
- Discover our top product DOK5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DOK5 Blocking Peptide, catalog no. 33R-3474, is also available for use as a blocking control in assays to test for specificity of this DOK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOK5 (Docking Protein 5 (DOK5))
- Alternative Name
- DOK5 (DOK5 Products)
- Synonyms
- C20orf180 antibody, 2700055C10Rik antibody, RGD1562846 antibody, docking protein 5 antibody, Docking protein 5 antibody, DOK5 antibody, dok5 antibody, Dok5 antibody
- Background
- DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. It interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.
- Molecular Weight
- 34 kDa (MW of target protein)
-