VPS37C antibody

Catalog No. ABIN631911

Product Details anti-VPS37C Antibody

Target: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS37C antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS37 C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS37C Blocking Peptide, catalog no. 33R-5323, is also available for use as a blocking control in assays to test for specificity of this VPS37C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS37C

Target: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Alternative Name: VPS37C (VPS37C Products)

Synonyms: RGD1309258 antibody, 5730409F24Rik antibody, AU042646 antibody, VPS37C, ESCRT-I subunit antibody, vacuolar protein sorting 37C antibody, VPS37C antibody, Vps37c antibody

Background: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies.

Molecular Weight: 39 kDa (MW of target protein)