MYL3/CMLC1 antibody (N-Term)

Catalog No. ABIN631908

Product Details anti-MYL3/CMLC1 Antibody

Target: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYL3/CMLC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYL3 antibody was raised against the N terminal of MYL3

Purification: Affinity purified

Immunogen: MYL3 antibody was raised using the N terminal of MYL3 corresponding to a region with amino acids VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYL3 Blocking Peptide, catalog no. 33R-9494, is also available for use as a blocking control in assays to test for specificity of this MYL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYL3/CMLC1

Target: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Alternative Name: MYL3 (MYL3 Products)

Synonyms: CMD1S antibody, CMH1 antibody, MPD1 antibody, MYHCB antibody, SPMD antibody, SPMM antibody, B-MHC antibody, MyHC-I antibody, Myhc-b antibody, Myhcb antibody, beta-MHC antibody, MLC1s antibody, MLC1v antibody, Mylc antibody, VLC1 antibody, Mylc1v antibody, CMH8 antibody, MLC1SB antibody, MLC1V antibody, mlc1v antibody, myl3-a antibody, myl3-b antibody, myl3.L antibody, zgc:103441 antibody, myosin heavy chain 7 antibody, myosin, heavy polypeptide 7, cardiac muscle, beta antibody, myosin, light polypeptide 3 antibody, myosin light chain 3 antibody, myosin light chain 3 S homeolog antibody, cardiac myosin light chain-1 antibody, MYH7 antibody, Myh7 antibody, Myl3 antibody, MYL3 antibody, myl3.S antibody, cmlc1 antibody

Background: MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform.

Molecular Weight: 22 kDa (MW of target protein)