MAGEA3 antibody (Middle Region)

Catalog No. ABIN631907

Product Details anti-MAGEA3 Antibody

Target: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAGEA3 antibody was raised against the middle region of MAGEA3

Purification: Affinity purified

Immunogen: MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA3 Blocking Peptide, catalog no. 33R-1420, is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA3

Target: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Alternative Name: MAGEA3 (MAGEA3 Products)

Synonyms: CT1.3 antibody, HIP8 antibody, HYPD antibody, MAGE3 antibody, MAGEA6 antibody, Mage-a3 antibody, MAGEA3 antibody, MAGE family member A3 antibody, melanoma antigen, family A, 3 antibody, melanoma antigen family A, 3 antibody, MAGEA3 antibody, Magea3 antibody

Background: MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molecular Weight: 35 kDa (MW of target protein)