EARS2 antibody
-
- Target See all EARS2 Antibodies
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EARS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
- Top Product
- Discover our top product EARS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
- Alternative Name
- EARS2 (EARS2 Products)
- Synonyms
- mse1 antibody, 3230401I01Rik antibody, AL024049 antibody, mKIAA1970 antibody, COXPD12 antibody, MSE1 antibody, RGD1307904 antibody, ears2 antibody, glutamyl-tRNA synthetase 2, mitochondrial antibody, zgc:153247 antibody, EARS2 antibody, ears2 antibody, Ears2 antibody, zgc:153247 antibody
- Background
- EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
- Molecular Weight
- 59 kDa (MW of target protein)
-