ARHGAP28 antibody (C-Term)
-
- Target See all ARHGAP28 Antibodies
- ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARHGAP28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARHGAP28 antibody was raised against the C terminal of ARHGAP28
- Purification
- Affinity purified
- Immunogen
- ARHGAP28 antibody was raised using the C terminal of ARHGAP28 corresponding to a region with amino acids AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD
- Top Product
- Discover our top product ARHGAP28 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARHGAP28 Blocking Peptide, catalog no. 33R-1293, is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))
- Alternative Name
- ARHGAP28 (ARHGAP28 Products)
- Synonyms
- RGD1559882 antibody, ARHGAP28 antibody, AU044757 antibody, AW550892 antibody, E130310N06 antibody, Rho GTPase activating protein 28 antibody, Arhgap28 antibody, ARHGAP28 antibody
- Background
- ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
- Molecular Weight
- 62 kDa (MW of target protein)
-