ERCC5 antibody (N-Term)

Catalog No. ABIN631899

Product Details anti-ERCC5 Antibody

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERCC5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERCC5 antibody was raised against the N terminal of ERCC5

Purification: Affinity purified

Immunogen: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERCC5

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Alternative Name: ERCC5 (ERCC5 Products)

Synonyms: COFS3 antibody, ERCM2 antibody, UVDR antibody, XPG antibody, XPGC antibody, cofs3 antibody, ercm2 antibody, uvdr antibody, xpg antibody, xpgc antibody, Xpg antibody, ERCC excision repair 5, endonuclease antibody, excision repair cross-complementation group 5 L homeolog antibody, excision repair cross-complementing rodent repair deficiency, complementation group 5 antibody, ERCC5 antibody, ercc5.L antibody, Ercc5 antibody

Background: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Molecular Weight: 133 kDa (MW of target protein)

Pathways: DNA Damage Repair