PAD4 antibody (Middle Region)
-
- Target See all PAD4 (PADI4) Antibodies
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PADI4 antibody was raised against the middle region of PADI4
- Purification
- Affinity purified
- Immunogen
- PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
- Top Product
- Discover our top product PADI4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
- Alternative Name
- PADI4 (PADI4 Products)
- Synonyms
- PAD antibody, PAD4 antibody, PADI5 antibody, PDI4 antibody, PDI5 antibody, Pad4 antibody, Pdi4 antibody, peptidyl arginine deiminase 4 antibody, peptidyl arginine deiminase, type IV antibody, PADI4 antibody, Padi4 antibody
- Background
- PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.
- Molecular Weight
- 74 kDa (MW of target protein)
-