DNALI1 antibody (N-Term)

Catalog No. ABIN631888

Product Details anti-DNALI1 Antibody

Target: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNALI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DNALI1 antibody was raised against the N terminal of DNALI1

Purification: Affinity purified

Immunogen: DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNALI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNALI1

Target: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Alternative Name: DNALI1 (DNALI1 Products)

Synonyms: zgc:171493 antibody, zgc:171595 antibody, P28 antibody, dJ423B22.5 antibody, hp28 antibody, 1700023A09Rik antibody, AW049135 antibody, dynein axonemal light intermediate chain 1 antibody, dynein, axonemal, light intermediate chain 1 antibody, dynein axonemal light intermediate chain 1 S homeolog antibody, dynein, axonemal, light intermediate polypeptide 1 antibody, DNALI1 antibody, dnali1 antibody, dnali1.S antibody, Dnali1 antibody

Background: DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Molecular Weight: 31 kDa (MW of target protein)