DNALI1 antibody (N-Term)
-
- Target See all DNALI1 Antibodies
- DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNALI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DNALI1 antibody was raised against the N terminal of DNALI1
- Purification
- Affinity purified
- Immunogen
- DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
- Top Product
- Discover our top product DNALI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNALI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))
- Alternative Name
- DNALI1 (DNALI1 Products)
- Background
- DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.
- Molecular Weight
- 31 kDa (MW of target protein)
-