PYCR2 antibody (C-Term)

Catalog No. ABIN631887

Product Details anti-PYCR2 Antibody

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PYCR2 antibody was raised against the C terminal of PYCR2

Purification: Affinity purified

Immunogen: PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYCR2 Blocking Peptide, catalog no. 33R-5055, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYCR2

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Alternative Name: PYCR2 (PYCR2 Products)

Synonyms: p5c antibody, p5cr antibody, pro3 antibody, pycr antibody, pig45 antibody, pp222 antibody, pycr2 antibody, arcl2b antibody, P5CR2 antibody, 1810018M05Rik antibody, P5cr2 antibody, pyrroline-5-carboxylate reductase 2 antibody, pyrroline-5-carboxylate reductase family, member 1 antibody, pyrroline-5-carboxylate reductase 1 antibody, pyrroline-5-carboxylate reductase family, member 2 antibody, pyrroline-5-carboxylate reductase 1b antibody, PYCR2 antibody, pycr1 antibody, PYCR1 antibody, Pycr2 antibody, pycr1b antibody

Background: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Molecular Weight: 34 kDa (MW of target protein)