PGLS antibody (Middle Region)
-
- Target See all PGLS Antibodies
- PGLS (6-phosphogluconolactonase (PGLS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PGLS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PGLS antibody was raised against the middle region of PGLS
- Purification
- Affinity purified
- Immunogen
- PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
- Top Product
- Discover our top product PGLS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGLS (6-phosphogluconolactonase (PGLS))
- Alternative Name
- PGLS (PGLS Products)
- Synonyms
- 6PGL antibody, PGLS antibody, PSPTO1301 antibody, 1110030K05Rik antibody, AI447866 antibody, Plgs antibody, 6-phosphogluconolactonase antibody, PGLS antibody, pgl antibody, CND03390 antibody, CNE04030 antibody, Tb11.02.4200 antibody, Pgls antibody
- Background
- PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
- Molecular Weight
- 28 kDa (MW of target protein)
-