CCDC54 antibody (N-Term)

Catalog No. ABIN631876

Product Details anti-CCDC54 Antibody

Target: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC54 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC54 antibody was raised against the N terminal of CCDC54

Purification: Affinity purified

Immunogen: CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC54 Blocking Peptide, catalog no. 33R-6277, is also available for use as a blocking control in assays to test for specificity of this CCDC54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC54

Target: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Alternative Name: CCDC54 (CCDC54 Products)

Synonyms: CCDC54 antibody, NYD-SP17 antibody, SP17 antibody, 1700007N18Rik antibody, AI644412 antibody, BB013989 antibody, RGD1559779 antibody, coiled-coil domain containing 54 antibody, CCDC54 antibody, Ccdc54 antibody

Background: The specific function of CCDC54 is not yet known.

Molecular Weight: 36 kDa (MW of target protein)