CDKL2 antibody

Catalog No. ABIN631873

Product Details anti-CDKL2 Antibody

Target: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDKL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDKL2

Target: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Alternative Name: CDKL2 (CDKL2 Products)

Synonyms: KKIAMRE antibody, P56 antibody, CDKL2 antibody, 5330436L21Rik antibody, AI505225 antibody, Kkm antibody, DKFZp459L235 antibody, kkiamre antibody, cyclin dependent kinase like 2 antibody, cyclin-dependent kinase-like 2 (CDC2-related kinase) antibody, cyclin dependent kinase like 2 L homeolog antibody, CDKL2 antibody, Cdkl2 antibody, cdkl2.L antibody

Background: This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Molecular Weight: 54 kDa (MW of target protein)