OSCP1 antibody (N-Term)

Catalog No. ABIN631871

Product Details anti-OSCP1 Antibody

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSCP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF102 antibody was raised against the N terminal Of C1 rf102

Purification: Affinity purified

Immunogen: C1 ORF102 antibody was raised using the N terminal Of C1 rf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF102 Blocking Peptide, catalog no. 33R-6525, is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF102 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSCP1

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Alternative Name: C1ORF102 (OSCP1 Products)

Synonyms: nor1 antibody, oscp1 antibody, zgc:171454 antibody, 1810007P19Rik antibody, 5730415O04 antibody, 6030436A01Rik antibody, RGD1306596 antibody, C1orf102 antibody, NOR1 antibody, organic solute carrier partner 1 antibody, organic solute carrier partner 1 L homeolog antibody, organic solute carrier partner 1a antibody, OSCP1 antibody, oscp1 antibody, oscp1.L antibody, oscp1a antibody, Oscp1 antibody

Background: C1ORF102 may be involved in drug clearance in the placenta.

Molecular Weight: 43 kDa (MW of target protein)