MORN4 antibody (Middle Region)

Catalog No. ABIN631870

Product Details anti-MORN4 Antibody

Target: MORN4 (MORN Repeat Containing 4 (MORN4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MORN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF83 antibody was raised against the middle region of C10 rf83

Purification: Affinity purified

Immunogen: C10 ORF83 antibody was raised using the middle region of C10 rf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF83 Blocking Peptide, catalog no. 33R-2907, is also available for use as a blocking control in assays to test for specificity of this C10ORF83 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF83 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MORN4

Target: MORN4 (MORN Repeat Containing 4 (MORN4))

Alternative Name: C10ORF83 (MORN4 Products)

Synonyms: zgc:113281 antibody, DKFZp459E156 antibody, C10orf83 antibody, bA548K23.4 antibody, C10ORF83 antibody, C26H10orf83 antibody, RGD1307336 antibody, MORN repeat containing 4 antibody, MORN4 antibody, morn4 antibody, Morn4 antibody

Background: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 16 kDa (MW of target protein)