MORN4 antibody (Middle Region)
-
- Target See all MORN4 Antibodies
- MORN4 (MORN Repeat Containing 4 (MORN4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MORN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C10 ORF83 antibody was raised against the middle region of C10 rf83
- Purification
- Affinity purified
- Immunogen
- C10 ORF83 antibody was raised using the middle region of C10 rf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA
- Top Product
- Discover our top product MORN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C10ORF83 Blocking Peptide, catalog no. 33R-2907, is also available for use as a blocking control in assays to test for specificity of this C10ORF83 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF83 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MORN4 (MORN Repeat Containing 4 (MORN4))
- Alternative Name
- C10ORF83 (MORN4 Products)
- Synonyms
- zgc:113281 antibody, DKFZp459E156 antibody, C10orf83 antibody, bA548K23.4 antibody, C10ORF83 antibody, C26H10orf83 antibody, RGD1307336 antibody, MORN repeat containing 4 antibody, MORN4 antibody, morn4 antibody, Morn4 antibody
- Background
- The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 16 kDa (MW of target protein)
-