NCRNA00114 antibody (N-Term)

Catalog No. ABIN631869

Product Details anti-NCRNA00114 Antibody

Target: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCRNA00114 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NCRNA00114 antibody was raised against the N terminal Of Ncrna00114

Purification: Affinity purified

Immunogen: NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCRNA00114 Blocking Peptide, catalog no. 33R-8438, is also available for use as a blocking control in assays to test for specificity of this NCRNA00114 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCRNA00114 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCRNA00114

Target: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Alternative Name: NCRNA00114 (NCRNA00114 Products)

Synonyms: C21orf24 antibody, NCRNA00114 antibody, long intergenic non-protein coding RNA 114 antibody, LINC00114 antibody

Background: The specific function of NCRNA00114 is not yet known.

Molecular Weight: 15 kDa (MW of target protein)