NCRNA00114 antibody (N-Term)
-
- Target See all NCRNA00114 products
- NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))
- Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NCRNA00114 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NCRNA00114 antibody was raised against the N terminal Of Ncrna00114
- Purification
- Affinity purified
- Immunogen
- NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NCRNA00114 Blocking Peptide, catalog no. 33R-8438, is also available for use as a blocking control in assays to test for specificity of this NCRNA00114 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCRNA00114 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))
- Alternative Name
- NCRNA00114 (NCRNA00114 Products)
- Synonyms
- C21orf24 antibody, NCRNA00114 antibody, long intergenic non-protein coding RNA 114 antibody, LINC00114 antibody
- Background
- The specific function of NCRNA00114 is not yet known.
- Molecular Weight
- 15 kDa (MW of target protein)
-