C21ORF45 antibody (N-Term)
-
- Target See all C21ORF45 (MIS18A) Antibodies
- C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))
- Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C21ORF45 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C21 ORF45 antibody was raised against the N terminal Of C21 rf45
- Purification
- Affinity purified
- Immunogen
- C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS
- Top Product
- Discover our top product MIS18A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))
- Alternative Name
- C21ORF45 (MIS18A Products)
- Background
- C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.
- Molecular Weight
- 26 kDa (MW of target protein)
-