C21ORF45 antibody (N-Term)

Catalog No. ABIN631868

Product Details anti-C21ORF45 Antibody

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21ORF45 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C21 ORF45 antibody was raised against the N terminal Of C21 rf45

Purification: Affinity purified

Immunogen: C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21ORF45

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Alternative Name: C21ORF45 (MIS18A Products)

Synonyms: B28 antibody, C21orf45 antibody, C21orf46 antibody, FASP1 antibody, MIS18alpha antibody, hMis18alpha antibody, 2610039C10Rik antibody, 2810018N07Rik antibody, RGD1310778 antibody, MIS18 kinetochore protein A antibody, MIS18A antibody, Mis18a antibody

Background: C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Molecular Weight: 26 kDa (MW of target protein)