KRT8 antibody (N-Term)

Catalog No. ABIN631865

Product Details anti-KRT8 Antibody

Target: KRT8 (Keratin 8 (KRT8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Cytokeratin 8 antibody was raised against the N terminal of KRT8

Purification: Affinity purified

Immunogen: Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 8 Blocking Peptide, catalog no. 33R-6446, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT8

Target: KRT8 (Keratin 8 (KRT8))

Alternative Name: Cytokeratin 8 (KRT8 Products)

Synonyms: CARD2 antibody, CK-8 antibody, CK8 antibody, CYK8 antibody, K2C8 antibody, K8 antibody, KO antibody, AA960620 antibody, AL022697 antibody, AU019895 antibody, Card2 antibody, EndoA antibody, Krt-2.8 antibody, Krt2-8 antibody, CYKER antibody, KRT2-8 antibody, KERATIN8 antibody, ck8 antibody, cyk8 antibody, k2c8 antibody, card2 antibody, krt2-5 antibody, MGC69490 antibody, KRT8 antibody, DreK8 antibody, cb186 antibody, krt2-8 antibody, sb:cb186 antibody, wu:fa20h05 antibody, wu:fa95h10 antibody, wu:fb96c06 antibody, zf-K8 antibody, zfk8 antibody, DKFZp468F2127 antibody, keratin 8 antibody, keratin 8 S homeolog antibody, KRT8 antibody, Krt8 antibody, krt8.S antibody, krt8 antibody

Background: KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.

Molecular Weight: 53 kDa (MW of target protein)