KRT8 antibody (N-Term)
-
- Target See all KRT8 Antibodies
- KRT8 (Keratin 8 (KRT8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KRT8 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Cytokeratin 8 antibody was raised against the N terminal of KRT8
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
- Top Product
- Discover our top product KRT8 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 8 Blocking Peptide, catalog no. 33R-6446, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT8 (Keratin 8 (KRT8))
- Alternative Name
- Cytokeratin 8 (KRT8 Products)
- Synonyms
- CARD2 antibody, CK-8 antibody, CK8 antibody, CYK8 antibody, K2C8 antibody, K8 antibody, KO antibody, AA960620 antibody, AL022697 antibody, AU019895 antibody, Card2 antibody, EndoA antibody, Krt-2.8 antibody, Krt2-8 antibody, CYKER antibody, KRT2-8 antibody, KERATIN8 antibody, ck8 antibody, cyk8 antibody, k2c8 antibody, card2 antibody, krt2-5 antibody, MGC69490 antibody, KRT8 antibody, DreK8 antibody, cb186 antibody, krt2-8 antibody, sb:cb186 antibody, wu:fa20h05 antibody, wu:fa95h10 antibody, wu:fb96c06 antibody, zf-K8 antibody, zfk8 antibody, DKFZp468F2127 antibody, keratin 8 antibody, keratin 8 S homeolog antibody, KRT8 antibody, Krt8 antibody, krt8.S antibody, krt8 antibody
- Background
- KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
- Molecular Weight
- 53 kDa (MW of target protein)
-