FN3KRP antibody (N-Term)

Catalog No. ABIN631861

Product Details anti-FN3KRP Antibody

Target: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FN3KRP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FN3 KRP antibody was raised against the N terminal of FN3 RP

Purification: Affinity purified

Immunogen: FN3 KRP antibody was raised using the N terminal of FN3 RP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FN3KRP Blocking Peptide, catalog no. 33R-5857, is also available for use as a blocking control in assays to test for specificity of this FN3KRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN0 RP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FN3KRP

Target: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Alternative Name: FN3KRP (FN3KRP Products)

Synonyms: FN3KL antibody, FN3K-RP antibody, fn3k antibody, fn3kl antibody, MGC145992 antibody, DKFZP469K211 antibody, RGD1304570 antibody, zgc:101634 antibody, fructosamine 3 kinase related protein antibody, fructosamine-3-kinase-related protein antibody, FN3KRP antibody, Fn3krp antibody, fn3krp antibody

Background: FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.

Molecular Weight: 34 kDa (MW of target protein)