CENPI antibody (N-Term)

Catalog No. ABIN631857

Product Details anti-CENPI Antibody

Target: CENPI (Centromere Protein I (CENPI))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPI antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CENPI antibody was raised against the N terminal of CENPI

Purification: Affinity purified

Immunogen: CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPI Blocking Peptide, catalog no. 33R-8690, is also available for use as a blocking control in assays to test for specificity of this CENPI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPI

Target: CENPI (Centromere Protein I (CENPI))

Alternative Name: CENPI (CENPI Products)

Synonyms: im:7159077 antibody, wu:fi32d01 antibody, CENP-I antibody, FSHPRH1 antibody, LRPR1 antibody, Mis6 antibody, AI504163 antibody, Fshprh1 antibody, RNALRP antibody, centromere protein I antibody, CENPI antibody, cenpi antibody, Cenpi antibody

Background: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Molecular Weight: 87 kDa (MW of target protein)