AASDH antibody (Middle Region)

Catalog No. ABIN631854

Product Details anti-AASDH Antibody

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AASDH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AASDH antibody was raised against the middle region of AASDH

Purification: Affinity purified

Immunogen: AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AASDH Blocking Peptide, catalog no. 33R-9009, is also available for use as a blocking control in assays to test for specificity of this AASDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AASDH

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Alternative Name: AASDH (AASDH Products)

Synonyms: u26 antibody, ACSF4 antibody, LYS2 antibody, NRPS1098 antibody, NRPS998 antibody, A230062G08Rik antibody, A830035E16 antibody, Acsf4 antibody, U26 antibody, RGD1311135 antibody, si:dkeyp-117h8.3 antibody, aminoadipate-semialdehyde dehydrogenase antibody, Aminoadipate-semialdehyde dehydrogenase, putative antibody, AASDH antibody, aasdh antibody, lys1 antibody, CNG00170 antibody, CC1G_15694 antibody, CGB_G6500C antibody, Aasdh antibody

Background: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.

Molecular Weight: 122 kDa (MW of target protein)