RFPL2 antibody (C-Term)
-
- Target See all RFPL2 products
- RFPL2 (Ret Finger Protein-Like 2 (RFPL2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RFPL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RFPL2 antibody was raised against the C terminal of RFPL2
- Purification
- Affinity purified
- Immunogen
- RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RFPL2 Blocking Peptide, catalog no. 33R-9802, is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFPL2 (Ret Finger Protein-Like 2 (RFPL2))
- Alternative Name
- RFPL2 (RFPL2 Products)
- Background
- RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.
- Molecular Weight
- 32 kDa (MW of target protein)
-