RFPL2 antibody (C-Term)

Catalog No. ABIN631850

Product Details anti-RFPL2 Antibody

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFPL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RFPL2 antibody was raised against the C terminal of RFPL2

Purification: Affinity purified

Immunogen: RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFPL2 Blocking Peptide, catalog no. 33R-9802, is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFPL2

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Alternative Name: RFPL2 (RFPL2 Products)

Synonyms: RNF79 antibody, RFPL2 antibody, ret finger protein like 2 antibody, ret finger protein-like 2 antibody, ret finger protein-like 3 antibody, RFPL2 antibody, LOC470188 antibody, LOC100601334 antibody

Background: RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Molecular Weight: 32 kDa (MW of target protein)