ROPN1B antibody (N-Term)
-
- Target See all ROPN1B Antibodies
- ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ROPN1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ROPN1 B antibody was raised against the N terminal of ROPN1
- Purification
- Affinity purified
- Immunogen
- ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE
- Top Product
- Discover our top product ROPN1B Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROPN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))
- Alternative Name
- ROPN1B (ROPN1B Products)
- Synonyms
- rhophilin associated tail protein 1B antibody, ROPN1B antibody
- Background
- ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.
- Molecular Weight
- 24 kDa (MW of target protein)
-