GNPDA1 antibody (C-Term)

Catalog No. ABIN631844

Product Details anti-GNPDA1 Antibody

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Binding Specificity: C-Term

Reactivity: Mouse, Human, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNPDA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GNPDA1 antibody was raised against the C terminal of GNPDA1

Purification: Affinity purified

Immunogen: GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNPDA1

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Alternative Name: GNPDA1 (GNPDA1 Products)

Synonyms: GNP1 antibody, GNPDA antibody, GNPI antibody, GPI antibody, HLN antibody, Gnp1 antibody, Gnpi antibody, oscillin antibody, gnpda antibody, gnpi antibody, gpi antibody, hln antibody, GNPDA1 antibody, zgc:110691 antibody, glucosamine-6-phosphate deaminase 1 antibody, glucosamine-6-phosphate deaminase 1 S homeolog antibody, Glucosamine-6-phosphate deaminase 1 antibody, GNPDA1 antibody, Gnpda1 antibody, gnpda1.S antibody, gnpda1 antibody, MSMEG_0501 antibody, nagB antibody, PPSC2_c4268 antibody

Background: GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

Molecular Weight: 33 kDa (MW of target protein)