DCXR antibody (Middle Region)

Catalog No. ABIN631837

Product Details anti-DCXR Antibody

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCXR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: DCXR antibody was raised against the middle region of DCXR

Purification: Affinity purified

Immunogen: DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCXR Blocking Peptide, catalog no. 33R-8869, is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCXR

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Alternative Name: DCXR (DCXR Products)

Synonyms: DCR antibody, HCR2 antibody, HCRII antibody, KIDCR antibody, P34H antibody, SDR20C1 antibody, XR antibody, dcxr antibody, DCXR antibody, DER antibody, 0610038K04Rik antibody, 1810027P18Rik antibody, glb antibody, wu:fa12f09 antibody, zgc:111977 antibody, GLB antibody, dicarbonyl and L-xylulose reductase antibody, dicarbonyl/L-xylulose reductase antibody, dicarbonyl L-xylulose reductase antibody, L-xylulose reductase antibody, L-xylulose reductase, putative antibody, dicarbonyl/L-xylulose reductase L homeolog antibody, DCXR antibody, dcxr antibody, Dcxr antibody, CNL05930 antibody, NCU09041 antibody, AOR_1_494194 antibody, VDBG_02657 antibody, CGB_D1070C antibody, dcxr.L antibody

Background: DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Monocarboxylic Acid Catabolic Process