Sec23 Homolog B antibody

Catalog No. ABIN631828

Product Details anti-Sec23 Homolog B Antibody

Target: Sec23 Homolog B (SEC23B)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sec23 Homolog B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SEC23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEC23B Blocking Peptide, catalog no. 33R-8439, is also available for use as a blocking control in assays to test for specificity of this SEC23B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sec23 Homolog B

Target: Sec23 Homolog B (SEC23B)

Alternative Name: SEC23B (SEC23B Products)

Background: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.

Molecular Weight: 86 kDa (MW of target protein)