MUC3B antibody (N-Term)

Catalog No. ABIN631826

Product Details anti-MUC3B Antibody

Target: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MUC3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MUC3 B antibody was raised against the N terminal of MUC3

Purification: Affinity purified

Immunogen: MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MUC3B Blocking Peptide, catalog no. 33R-4649, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MUC3B

Target: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Alternative Name: MUC3B (MUC3B Products)

Synonyms: MUC3 antibody, MUC3A antibody, MUC3B antibody, mucin 3B, cell surface associated antibody, mucin-3B antibody, MUC3B antibody, LOC463613 antibody

Background: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Molecular Weight: 34 kDa (MW of target protein)