FBXW10 antibody (N-Term)

Catalog No. ABIN631823

Product Details anti-FBXW10 Antibody

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXW10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXW10 antibody was raised against the N terminal of FBXW10

Purification: Affinity purified

Immunogen: FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXW10

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Alternative Name: FBXW10 (FBXW10 Products)

Synonyms: Fbw10 antibody, HREP antibody, SM25H2 antibody, SM2SH2 antibody, CMT1A duplicated region transcript 1 antibody, F-box and WD repeat domain containing 10 antibody, tripartite motif containing 16 antibody, F-box and WD-40 domain protein 10 antibody, CDRT1 antibody, FBXW10 antibody, Fbxw10 antibody, Cdrt1 antibody, TRIM16 antibody

Background: Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 120 kDa (MW of target protein)