ZFP14 antibody (N-Term)
-
- Target See all ZFP14 Antibodies
- ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZFP14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZNF14 antibody was raised against the N terminal of ZNF14
- Purification
- Affinity purified
- Immunogen
- ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC
- Top Product
- Discover our top product ZFP14 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZNF14 Blocking Peptide, catalog no. 33R-4231, is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))
- Alternative Name
- ZNF14 (ZFP14 Products)
- Background
- ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.
- Molecular Weight
- 71 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin
-