STAMBPL1 antibody (N-Term)

Catalog No. ABIN631818

Product Details anti-STAMBPL1 Antibody

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAMBPL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STAMBPL1 antibody was raised against the N terminal of STAMBPL1

Purification: Affinity purified

Immunogen: STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAMBPL1 Blocking Peptide, catalog no. 33R-5863, is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAMBPL1

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Alternative Name: STAMBPL1 (STAMBPL1 Products)

Synonyms: amsh-lp antibody, MGC75962 antibody, MGC84444 antibody, AMSHLP antibody, DKFZp459M0218 antibody, 1700095N21Rik antibody, 8230401J17Rik antibody, ALMalpha antibody, AMSH-FP antibody, AMSH-LP antibody, bA399O19.2 antibody, STAM binding protein like 1 antibody, STAM binding protein like 1 L homeolog antibody, stambpl1 antibody, stambpl1.L antibody, STAMBPL1 antibody, Stambpl1 antibody

Background: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.

Molecular Weight: 50 kDa (MW of target protein)