HIPK4 antibody (Middle Region)
-
- Target See all HIPK4 Antibodies
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HIPK4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HIPK4 antibody was raised against the middle region of HIPK4
- Purification
- Affinity purified
- Immunogen
- HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET
- Top Product
- Discover our top product HIPK4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
- Alternative Name
- HIPK4 (HIPK4 Products)
- Synonyms
- Gm162 antibody, homeodomain interacting protein kinase 4 antibody, HIPK4 antibody, Hipk4 antibody
- Background
- HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.
- Molecular Weight
- 69 kDa (MW of target protein)
-