C10ORF96 antibody (Middle Region)

Catalog No. ABIN631805

Product Details anti-C10ORF96 Antibody

Target: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C10ORF96 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF96 antibody was raised against the middle region of C10 rf96

Purification: Affinity purified

Immunogen: C10 ORF96 antibody was raised using the middle region of C10 rf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF96 Blocking Peptide, catalog no. 33R-7472, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF96 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C10ORF96

Target: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Alternative Name: C10ORF96 (C10orf96 Products)

Synonyms: C9H10orf96 antibody, C10orf96 antibody, C26H10orf96 antibody, 1700011F14Rik antibody, coiled-coil domain containing 172 antibody, coiled-coil domain containing 172 L homeolog antibody, CCDC172 antibody, Ccdc172 antibody, ccdc172.L antibody

Background: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)